We are an online life science research collective.
We provide and use open tools and infrastructure for computational life science research.
Instead of spending time setting up and hosting a tool locally, get started immediately. Interact with clearly defined input fields, get access to all parameters and kick off multiple jobs in parallel.
We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.
Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.
Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.
We’re a group of scientists, operators, and engineers who’ve experienced the limits of academia first hand.
If you’re interested in building a scientific organization for the 21st century, get in touch.
{
"input": [
{
"name": "gp47_tail",
"sequence": "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV. RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC", "parameters": {
"max_template_date": "2022-01-01",
"mode": "monomer_single",
"weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",
"db": "full",
"is_prokaryote": 0
}
}
]
}
